PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606781.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 338aa    MW: 38591.5 Da    PI: 7.3587
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606781.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l ++++++G g+W++ ++  g++R++k+c++rw +yl
   XP_009606781.1 14 KGPWTPEEDQKLTNYINKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.41.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia +++ gRt++++k++w+++l
   XP_009606781.1  67 RGKFSQEEEQTILNLHAVLGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.399961IPR017930Myb domain
SuperFamilySSF466898.07E-3211108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002492.5E-171461IPR001005SANT/Myb domain
CDDcd001676.26E-121661No hitNo description
PROSITE profilePS5129427.0762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2865117IPR009057Homeodomain-like
SMARTSM007171.5E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1667112IPR001005SANT/Myb domain
CDDcd001675.34E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRSPCCEEN GLKKGPWTPE EDQKLTNYIN KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHAVLGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPMTHRPRT DIFNSLQHLI ALANLKELME HQYLQNLLQT HNNISFNTSI QDIEAYNLLN  180
SLSSLKDSQF LGTNNHMENH LISSPNSSLQ AQDLIPFSHL PELQTSCSFQ NLINKDKVRP  240
QNTDFTVLSN GETLSPTSPW IPSALSPSPP RPSLTNDQRR KENSSEMVVS SCLPEERKLP  300
DYLFQPDSER ALSNEGAPPS IWPDLLLEDS FFQDIPKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754435e-42HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankHG9755165e-42HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606781.10.0PREDICTED: myb-related protein 330-like
SwissprotQ8GWP01e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLK4C1I61e-164K4C1I6_SOLLC; Uncharacterized protein
STRINGSolyc05g051550.1.11e-164(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-96myb domain protein 93